PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009631884.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 278aa    MW: 31827.7 Da    PI: 6.5098
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009631884.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.2e-152168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT +Ed +l++++ +lG g+W++ a+  g++Rt+k+c++rw +yl
   XP_009631884.1 21 KGGWTLDEDSKLIHYISLLGQGRWDSLAHFAGLKRTGKSCRLRWMNYL 68
                     688*******************************************97 PP

2Myb_DNA-binding46.58.3e-1574117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg  T++E++l++ ++ ++G++ W++Ia++++ gRt++++k++w++
   XP_009631884.1  74 RGELTPQEQLLILLLHFRYGNR-WAKIAEHLP-GRTDNEVKNYWRT 117
                      7888******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.8721668IPR017930Myb domain
SuperFamilySSF466897.35E-2819115IPR009057Homeodomain-like
SMARTSM007174.3E-132070IPR001005SANT/Myb domain
PfamPF002491.9E-142168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-192375IPR009057Homeodomain-like
CDDcd001671.67E-102468No hitNo description
PROSITE profilePS5129420.67769123IPR017930Myb domain
SMARTSM007174.3E-1473121IPR001005SANT/Myb domain
PfamPF002494.9E-1474117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2176121IPR009057Homeodomain-like
CDDcd001679.25E-1178117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MEEEKATERL YSAQEKVKMT KGGWTLDEDS KLIHYISLLG QGRWDSLAHF AGLKRTGKSC  60
RLRWMNYLRP NLRRGELTPQ EQLLILLLHF RYGNRWAKIA EHLPGRTDNE VKNYWRTKVQ  120
KHAKQLHCDV NSLQFRDFLH YQWLPRLTEQ IRATSSSQEQ LMSSSSSFTS HNNTEVLILE  180
NSTFLQTGIN GSTNITCPIN HTPNVAEVTS LIDDSIWNLS SGNRTSGFED GFSDLSSTDM  240
AVYSNSQDQC HSWASAGSEV LLPDETLGLN DMDLWLFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-241912125126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631883.10.0PREDICTED: transcription factor MYB108-like isoform X1
RefseqXP_009631884.10.0PREDICTED: transcription factor MYB108-like isoform X1
SwissprotQ9LDE13e-61MY108_ARATH; Transcription factor MYB108
TrEMBLK4C3X81e-79K4C3X8_SOLLC; Uncharacterized protein
STRINGSolyc06g009480.1.13e-79(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.14e-64myb domain protein 112